Homepage | Set Home | Add to Favorites
Member

Wuhan Pharma Chemical Co., Ltd.

Shipping Information:
Main Export Markets:
Inquiry


Products
  • No Category
Search
 

Friends links
  • No link

Lyophilized Peptide Long R3 IGF-1 Top Quality IGF-1 LR3 Increase Protein
Click image to view full size image
Product: Views:27Lyophilized Peptide Long R3 IGF-1 Top Quality IGF-1 LR3 Increase Protein 
Unit price: Negotiable
MOQ:
Quantity:
Delivery date: Since the payment date Days delivery
Valid until: Long-term effective
Last updated: 2017-09-19 17:21
  Inquiry
Details
Model Number: IGF-1 LR3 Brand Name: Biopharm Key Specifications/Special Features: SpecificationName: IGF-1 LR3Synonyms: long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1CAS No.: 946870-92-4Molecular formula: C400H625N111O115S9Molecular mass: 9117.5 Da (g/mol)Amino acid sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSAPurityIGF-1 LR3 has a peptide purity level that exceeds 95.0% as determined by HPLC and MS
Product Name IGF-1 LR3 Other Name Long R3 IGF-1
Chemical Name Long Arg3 IGF-1 Abb. Name: LR3 IGF
CAS No. 946870-92-4 Molecular Formula C400H625N111O115S9
Product Type Lyophilized Powder Color White
Standard Pharmaceutical Grade Package 1 mg/vial
0.1 mg/vial